PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.044950.1
Common NameCsa_6G513430, LOC101211566
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 352aa    MW: 39291.2 Da    PI: 5.8723
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.044950.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-092793132155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+++gL+++q+ +WF N+R ++
  Cucsa.044950.1 279 KWPYPSESQKLALAQSTGLDQKQINNWFINQRKRH 313
                     569*****************************885 PP

2ELK41.23.5e-14233254122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLgsLkqEF+
  Cucsa.044950.1 233 ELKGQLLRKYSGYLGSLKQEFM 254
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.4E-1993137IPR005540KNOX1
PfamPF037906.5E-2295133IPR005540KNOX1
SMARTSM012565.7E-24144195IPR005541KNOX2
PfamPF037914.4E-20147193IPR005541KNOX2
PfamPF037895.8E-11233254IPR005539ELK domain
SMARTSM011882.8E-8233254IPR005539ELK domain
PROSITE profilePS5121311.174233253IPR005539ELK domain
PROSITE profilePS5007113.005253316IPR001356Homeobox domain
SuperFamilySSF466891.88E-19255329IPR009057Homeodomain-like
SMARTSM003897.7E-13255320IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-28258318IPR009057Homeodomain-like
CDDcd000861.21E-12265317No hitNo description
PfamPF059206.3E-17273312IPR008422Homeobox KN domain
PROSITE patternPS000270291314IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MDVPSGNCSG GMMNFGDQNN NNNNNNGLCS MMMMMPLISA SQQGGDGSSC TPFLPLPPPN  60
YNNNNNTSIC NYFMDETNNN NNDESSNGAN SCCEVKAKIM AHPHYHRLLA AYVNCRKVGA  120
PPEVVARLEE ACASAVTMSS GNNGGGCIGE DPALDQFMEA YCEMLTKYEQ ELSKPFRDAM  180
LFLQRIDSQF KALSISSSHL PPACGEAFDR NGSSEEEVDI NGHSIDPQAE DRELKGQLLR  240
KYSGYLGSLK QEFMKKRKKG KLPKEARQQL LDWWSRHYKW PYPSESQKLA LAQSTGLDQK  300
QINNWFINQR KRHWKPSEDM QFVVMDAAHP QYYMDTVLGN PFPLDISPAL L*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1248257LKQEFMKKRK
2254258KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818751e-133LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132621e-133LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004134981.20.0PREDICTED: homeobox protein knotted-1-like LET6
SwissprotP466081e-147HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0A0KJU40.0A0A0A0KJU4_CUCSA; Uncharacterized protein
STRINGVIT_12s0059g01190.t011e-156(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-136KNOX/ELK homeobox transcription factor
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]